PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_70A738C1B.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 185aa    MW: 19855.7 Da    PI: 10.3569
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_70A738C1B.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.12e-101321824294
                            TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                     B3  42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                            +  +++vk+ +++++++ + ++GW++Fv  n+L  g +v+F+ld++s +  vv
  Traes_2AS_70A738C1B.2 132 NKHTYTVKC-HKGRKQSALYGRGWRKFVAHNKLGKGQMVLFYLDQHSPR-AVV 182
                            447889999.6788888999***********************986433.344 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-8125177IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-8132180IPR015300DNA-binding pseudobarrel domain
PfamPF023626.7E-8132182IPR003340B3 DNA binding domain
CDDcd100171.62E-8134184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSLFCRLGQS AGGAVNKGGE EDVGLVVIKR RGTASQFISS FSLYSSLSNL KICSGTKKSM  60
CSSTASERTG GAADGIRDGL HSLSEPLLTA RAGEAASVCM SGRSSRREGV VTCNERVCSD  120
NLTGDRLTFK ANKHTYTVKC HKGRKQSALY GRGWRKFVAH NKLGKGQMVL FYLDQHSPRA  180
VVCVV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5B2961e-134W5B296_WHEAT; Uncharacterized protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]